Class b: All beta proteins [48724] (174 folds) |
Fold b.78: beta-Prism II [51109] (1 superfamily) consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis duplication: consists of two domains of this fold |
Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) |
Family b.78.1.0: automated matches [191418] (1 protein) not a true family |
Protein automated matches [190587] (3 species) not a true protein |
Species Curculigo latifolia [TaxId:4676] [187595] (2 PDB entries) |
Domain d2dpfb_: 2dpf B: [163650] automated match to d1npla_ complexed with so4 |
PDB Entry: 2dpf (more details), 1.5 Å
SCOPe Domain Sequences for d2dpfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dpfb_ b.78.1.0 (B:) automated matches {Curculigo latifolia [TaxId: 4676]} dnvllsgqtlhadhslqagaytltiqnkcnlvkyqngrqiwasntdrrgsgcrltllsdg nlviydhnnndvwgsacwgdngkyalvlqkdgrfviygpvlwslgpngcrr
Timeline for d2dpfb_: