Lineage for d2dpfb_ (2dpf B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962207Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 962208Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 962256Family b.78.1.0: automated matches [191418] (1 protein)
    not a true family
  6. 962257Protein automated matches [190587] (3 species)
    not a true protein
  7. 962263Species Curculigo latifolia [TaxId:4676] [187595] (2 PDB entries)
  8. 962265Domain d2dpfb_: 2dpf B: [163650]
    automated match to d1npla_
    complexed with so4

Details for d2dpfb_

PDB Entry: 2dpf (more details), 1.5 Å

PDB Description: Crystal Structure of curculin1 homodimer
PDB Compounds: (B:) Curculin

SCOPe Domain Sequences for d2dpfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dpfb_ b.78.1.0 (B:) automated matches {Curculigo latifolia [TaxId: 4676]}
dnvllsgqtlhadhslqagaytltiqnkcnlvkyqngrqiwasntdrrgsgcrltllsdg
nlviydhnnndvwgsacwgdngkyalvlqkdgrfviygpvlwslgpngcrr

SCOPe Domain Coordinates for d2dpfb_:

Click to download the PDB-style file with coordinates for d2dpfb_.
(The format of our PDB-style files is described here.)

Timeline for d2dpfb_: