Lineage for d2djxb_ (2djx B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1816697Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1816698Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1817085Protein automated matches [190228] (15 species)
    not a true protein
  7. 1817182Species Trypanosoma cruzi [TaxId:5693] [187324] (7 PDB entries)
  8. 1817190Domain d2djxb_: 2djx B: [163643]
    automated match to d2b4ga1
    complexed with fmn, nco

Details for d2djxb_

PDB Entry: 2djx (more details), 1.58 Å

PDB Description: Crystal structure of native Trypanosoma cruzi dihydroorotate dehydrogenase
PDB Compounds: (B:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d2djxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2djxb_ c.1.4.1 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mclklnlldhvfanpfmnaagvlccteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

SCOPe Domain Coordinates for d2djxb_:

Click to download the PDB-style file with coordinates for d2djxb_.
(The format of our PDB-style files is described here.)

Timeline for d2djxb_: