SCOP 1.57: Domain d1fjgm_: 1fjg M:

Lineage for d1fjgm_ (1fjg M:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)

4. Superfamily a.5.5: Ribosomal protein S13 [46946] (1 family)

5. Family a.5.5.1: Ribosomal protein S13 [46947] (1 protein)

6. Protein Ribosomal protein S13 [46948] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46949] (10 PDB entries)

8. Domain d1fjgm_: 1fjg M: [16293]
   Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_

Details for d1fjgm_

PDB Entry: 1fjg, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgm_:

Sequence; same for both SEQRES and ATOM records:

>d1fjgm_ a.5.5.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

Timeline for d1fjgm_:

• d1fjgm_ first appeared (with stable ids) in SCOP 1.55
  
• d1fjgm_ appears in SCOP 1.59
  
• d1fjgm_ appears in the current release, SCOPe 2.08