Lineage for d1fjgd_ (1fjg D:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81032Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
  4. 81033Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (3 families) (S)
  5. 81038Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
  6. 81039Protein Ribosomal protein S4 [55179] (2 species)
  7. 81043Species Thermus thermophilus [TaxId:274] [55180] (10 PDB entries)
  8. 81045Domain d1fjgd_: 1fjg D: [39553]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_

Details for d1fjgd_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgd_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvqenlviefysr

SCOP Domain Coordinates for d1fjgd_:

Click to download the PDB-style file with coordinates for d1fjgd_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgd_: