SCOP 1.57: Domain d1fjgr_: 1fjg R:

Lineage for d1fjgr_ (1fjg R:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (11 PDB entries)

8. Domain d1fjgr_: 1fjg R: [16252]
   Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgs_, d1fjgt_, d1fjgv_

Details for d1fjgr_

PDB Entry: 1fjg, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgr_:

Sequence; same for both SEQRES and ATOM records:

>d1fjgr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d1fjgr_:

• d1fjgr_ first appeared (with stable ids) in SCOP 1.55
  
• d1fjgr_ appears in SCOP 1.59
  
• d1fjgr_ appears in the current release, SCOPe 2.08