Lineage for d1xg2b_ (1xg2 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1732299Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families) (S)
    contains a short alpha-hairpin at the N-terminal extension
  5. 1732331Family a.29.6.0: automated matches [191503] (1 protein)
    not a true family
  6. 1732332Protein automated matches [190825] (1 species)
    not a true protein
  7. 1732333Species Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId:3625] [188117] (1 PDB entry)
  8. 1732334Domain d1xg2b_: 1xg2 B: [162063]
    Other proteins in same PDB: d1xg2a_
    automated match to d1x90a_

Details for d1xg2b_

PDB Entry: 1xg2 (more details), 1.9 Å

PDB Description: Crystal structure of the complex between pectin methylesterase and its inhibitor protein
PDB Compounds: (B:) Pectinesterase inhibitor

SCOPe Domain Sequences for d1xg2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xg2b_ a.29.6.0 (B:) automated matches {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]}
fenhliseicpktrnpslclqalesdprsaskdlkglgqfsidiaqasakqtskiiaslt
nqatdpklkgryetcsenyadaidslgqakqfltsgdynslniyasaafdgagtcedsfe
gppniptqlhqadlkledlcdivlvisnllp

SCOPe Domain Coordinates for d1xg2b_:

Click to download the PDB-style file with coordinates for d1xg2b_.
(The format of our PDB-style files is described here.)

Timeline for d1xg2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xg2a_