Class b: All beta proteins [48724] (176 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.1: Pectin lyase-like [51126] (12 families) superhelix turns are made of 3 strands each |
Family b.80.1.5: Pectin methylesterase [51147] (2 proteins) automatically mapped to Pfam PF01095 this is a repeat family; one repeat unit is 1qjv A:170-291 found in domain |
Protein automated matches [190742] (2 species) not a true protein |
Species Solanum lycopersicum [TaxId:4081] [188116] (1 PDB entry) |
Domain d1xg2a_: 1xg2 A: [162062] Other proteins in same PDB: d1xg2b_ automated match to d1gq8a_ |
PDB Entry: 1xg2 (more details), 1.9 Å
SCOPe Domain Sequences for d1xg2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xg2a_ b.80.1.5 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]} iianavvaqdgtgdyqtlaeavaaapdksktryviyvkrgtykenvevasnkmnlmivgd gmyattitgslnvvdgsttfrsatlaavgqgfilqdiciqntagpakdqavalrvgadms vinrcridayqdtlyahsqrqfyrdsyvtgtvdfifgnaavvfqkcqlvarkpgkyqqnm vtaqgrtdpnqatgtsiqfcniiassdlepvlkefptylgrpwkeysrtvvmesylggli npagwaewdgdfalktlyygefmnngpgagtskrvkwpgyhvitdpakampftvakliqg gswlrstgvayvdglyd
Timeline for d1xg2a_: