SCOPe 2.04: Domain d1xg2b_: 1xg2 B:

Lineage for d1xg2b_ (1xg2 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families)
   contains a short alpha-hairpin at the N-terminal extension

5. Family a.29.6.0: automated matches [191503] (1 protein)
   not a true family

6. Protein automated matches [190825] (1 species)
   not a true protein

7. Species Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId:3625] [188117] (1 PDB entry)

8. Domain d1xg2b_: 1xg2 B: [162063]
   Other proteins in same PDB: d1xg2a_
   automated match to d1x90a_

Details for d1xg2b_

PDB Entry: 1xg2, 1.9 Å

PDB Description: Crystal structure of the complex between pectin methylesterase and its inhibitor protein

PDB Compounds: (B:) Pectinesterase inhibitor

SCOPe Domain Sequences for d1xg2b_:

Sequence; same for both SEQRES and ATOM records:

>d1xg2b_ a.29.6.0 (B:) automated matches {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]}
fenhliseicpktrnpslclqalesdprsaskdlkglgqfsidiaqasakqtskiiaslt
nqatdpklkgryetcsenyadaidslgqakqfltsgdynslniyasaafdgagtcedsfe
gppniptqlhqadlkledlcdivlvisnllp

Timeline for d1xg2b_:

• d1xg2b_ first appeared in SCOPe 2.01
  
• d1xg2b_ appears in SCOPe 2.03
  
• d1xg2b_ appears in SCOPe 2.05
  
• d1xg2b_ appears in the current release, SCOPe 2.08, called d1xg2b1