Lineage for d2bbya_ (2bby A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693342Family a.4.5.15: DNA-binding domain from rap30 [46841] (1 protein)
    automatically mapped to Pfam PF02270
  6. 2693343Protein DNA-binding domain from rap30 [46842] (1 species)
  7. 2693344Species Human (Homo sapiens) [TaxId:9606] [46843] (2 PDB entries)
  8. 2693345Domain d2bbya_: 2bby A: [16148]

Details for d2bbya_

PDB Entry: 2bby (more details)

PDB Description: dna-binding domain from human rap30, nmr, 30 structures
PDB Compounds: (A:) rap30

SCOPe Domain Sequences for d2bbya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bbya_ a.4.5.15 (A:) DNA-binding domain from rap30 {Human (Homo sapiens) [TaxId: 9606]}
raradkqhvldmlfsafekhqyynlkdlvditkqpvvylkeilkeigvqnvkgihkntwe
lkpeyrhyq

SCOPe Domain Coordinates for d2bbya_:

Click to download the PDB-style file with coordinates for d2bbya_.
(The format of our PDB-style files is described here.)

Timeline for d2bbya_: