Lineage for d2bby__ (2bby -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1553Family a.4.5.15: DNA-binding domain from rap30 [46841] (1 protein)
  6. 1554Protein DNA-binding domain from rap30 [46842] (1 species)
  7. 1555Species Human (Homo sapiens) [TaxId:9606] [46843] (2 PDB entries)
  8. 1556Domain d2bby__: 2bby - [16148]

Details for d2bby__

PDB Entry: 2bby (more details)

PDB Description: dna-binding domain from human rap30, nmr, 30 structures

SCOP Domain Sequences for d2bby__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bby__ a.4.5.15 (-) DNA-binding domain from rap30 {Human (Homo sapiens)}
raradkqhvldmlfsafekhqyynlkdlvditkqpvvylkeilkeigvqnvkgihkntwe
lkpeyrhyq

SCOP Domain Coordinates for d2bby__:

Click to download the PDB-style file with coordinates for d2bby__.
(The format of our PDB-style files is described here.)

Timeline for d2bby__: