PDB entry 2bby

View 2bby on RCSB PDB site
Description: DNA-binding domain from human rap30, nmr, 30 structures
Class: transcription regulation
Keywords: transcription regulation, rap30, nmr, DNA-binding domain
Deposited on 1998-04-27, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rap30
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13984 (0-68)
  Domains in SCOPe 2.08: d2bbya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bbyA (A:)
  raradkqhvldmlfsafekhqyynlkdlvditkqpvvylkeilkeigvqnvkgihkntwe
  lkpeyrhyq