SCOP 1.65: Domain d1a5j_2: 1a5j 56-110

Lineage for d1a5j_2 (1a5j 56-110)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (11 families)
   consists only of helices

5. Family a.4.1.3: Myb [46739] (4 proteins)

6. Protein b-Myb DNA binding domain [46743] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [46744] (1 PDB entry)

8. Domain d1a5j_2: 1a5j 56-110 [16044]
   repeats 2 & 3

Details for d1a5j_2

PDB Entry: 1a5j

PDB Description: chicken b-myb dna binding domain, repeat 2 and repeat3, nmr, 32 structures

SCOP Domain Sequences for d1a5j_2:

Sequence; same for both SEQRES and ATOM records:

>d1a5j_2 a.4.1.3 (56-110) b-Myb DNA binding domain {Chicken (Gallus gallus)}
evkksswteeedriifeahkvlgnrwaeiakllpgrtdnavknhwnstikrkvdt

Timeline for d1a5j_2:

• d1a5j_2 first appeared (with stable ids) in SCOP 1.55
  
• d1a5j_2 appears in SCOP 1.63
  
• d1a5j_2 appears in SCOP 1.67
  
• d1a5j_2 appears in the current release, SCOPe 2.08, called d1a5ja2