Lineage for d1a5j_1 (1a5j 1-55)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277522Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 277664Family a.4.1.3: Myb [46739] (4 proteins)
  6. 277665Protein b-Myb DNA binding domain [46743] (1 species)
  7. 277666Species Chicken (Gallus gallus) [TaxId:9031] [46744] (1 PDB entry)
  8. 277667Domain d1a5j_1: 1a5j 1-55 [16043]

Details for d1a5j_1

PDB Entry: 1a5j (more details)

PDB Description: chicken b-myb dna binding domain, repeat 2 and repeat3, nmr, 32 structures

SCOP Domain Sequences for d1a5j_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5j_1 a.4.1.3 (1-55) b-Myb DNA binding domain {Chicken (Gallus gallus)}
gipdlvkgpwtkeedqkvielvkkygtkqwtliakhlkgrlgkqcrerwhnhlnp

SCOP Domain Coordinates for d1a5j_1:

Click to download the PDB-style file with coordinates for d1a5j_1.
(The format of our PDB-style files is described here.)

Timeline for d1a5j_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5j_2