Lineage for d1a5j_2 (1a5j 56-110)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1333Family a.4.1.3: Myb [46739] (2 proteins)
  6. 1334Protein b-Myb DNA binding domain [46743] (1 species)
  7. 1335Species Chicken (Gallus gallus) [TaxId:9031] [46744] (1 PDB entry)
  8. 1337Domain d1a5j_2: 1a5j 56-110 [16044]

Details for d1a5j_2

PDB Entry: 1a5j (more details)

PDB Description: chicken b-myb dna binding domain, repeat 2 and repeat3, nmr, 32 structures

SCOP Domain Sequences for d1a5j_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5j_2 a.4.1.3 (56-110) b-Myb DNA binding domain {Chicken (Gallus gallus)}
evkksswteeedriifeahkvlgnrwaeiakllpgrtdnavknhwnstikrkvdt

SCOP Domain Coordinates for d1a5j_2:

Click to download the PDB-style file with coordinates for d1a5j_2.
(The format of our PDB-style files is described here.)

Timeline for d1a5j_2:

1337
d1a5j_2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1a5j_1