Lineage for d1c2rb_ (1c2r B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690809Protein Cytochrome c2 [46650] (8 species)
  7. 2690813Species Rhodobacter capsulatus [TaxId:1061] [46652] (3 PDB entries)
    Uniprot P00094
  8. 2690815Domain d1c2rb_: 1c2r B: [15888]
    complexed with hec

Details for d1c2rb_

PDB Entry: 1c2r (more details), 2.5 Å

PDB Description: molecular structure of cytochrome c2 isolated from rhodobacter capsulatus determined at 2.5 angstroms resolution
PDB Compounds: (B:) cytochrome c2

SCOPe Domain Sequences for d1c2rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2rb_ a.3.1.1 (B:) Cytochrome c2 {Rhodobacter capsulatus [TaxId: 1061]}
gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
gasgfawteediatyvkdpgaflkeklddkkaktgmafklakggedvaaylasvvk

SCOPe Domain Coordinates for d1c2rb_:

Click to download the PDB-style file with coordinates for d1c2rb_.
(The format of our PDB-style files is described here.)

Timeline for d1c2rb_: