Lineage for d1c2rb_ (1c2r B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) 
Protein Cytochrome c2 [46650] (7 species) 
Species Rhodobacter capsulatus [TaxId:1061] [46652] (2 PDB entries) 
Domain d1c2rb_: 1c2r B: [15888]
Details for d1c2rb_
PDB Entry: 1c2r (more details), 2.5 Å
PDB Description: molecular structure of cytochrome c2 isolated from rhodobacter capsulatus determined at 2.5 angstroms resolution
SCOP Domain Sequences for d1c2rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c2rb_ a.3.1.1 (B:) Cytochrome c2 {Rhodobacter capsulatus}
gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
gasgfawteediatyvkdpgaflkeklddkkaktgmafklakggedvaaylasvvk
SCOP Domain Coordinates for d1c2rb_:
Click to download the PDB-style file with coordinates for d1c2rb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c2rb_:
- d1c2rb_ appears in SCOP 1.57
- d1c2rb_ appears in the current release, SCOPe 2.08
View in 3D
