Lineage for d3e47w_ (3e47 W:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (9 species)
    contains an extension to the common fold at the N-terminus
  7. 2549053Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (235 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2549558Domain d3e47w_: 3e47 W: [158018]
    Other proteins in same PDB: d3e47g_, d3e47u_
    automated match to d4eu2j_
    complexed with esy

Details for d3e47w_

PDB Entry: 3e47 (more details), 3 Å

PDB Description: Crystal Structure of the Yeast 20S Proteasome in Complex with Homobelactosin C
PDB Compounds: (W:) Proteasome component PUP3

SCOPe Domain Sequences for d3e47w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e47w_ d.153.1.4 (W:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOPe Domain Coordinates for d3e47w_:

Click to download the PDB-style file with coordinates for d3e47w_.
(The format of our PDB-style files is described here.)

Timeline for d3e47w_: