SCOPe 2.06: Domain d1ewaa_: 1ewa A:

Lineage for d1ewaa_ (1ewa A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (31 PDB entries)

8. Domain d1ewaa_: 1ewa A: [15639]
   complexed with hem, iol, so4

Details for d1ewaa_

PDB Entry: 1ewa, 2.5 Å

PDB Description: Dehaloperoxidase and 4-iodophenol

PDB Compounds: (A:) dehaloperoxidase

SCOPe Domain Sequences for d1ewaa_:

Sequence; same for both SEQRES and ATOM records:

>d1ewaa_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d1ewaa_:

• d1ewaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ewaa_ appears in SCOPe 2.05
  
• d1ewaa_ appears in SCOPe 2.07
  
• d1ewaa_ appears in the current release, SCOPe 2.08