Lineage for d1ewaa_ (1ewa A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) 
Protein Dehaloperoxidase [46530] (1 species) Species Marine worm (Amphitrite ornata) [46531] (2 PDB entries) 
Domain d1ewaa_: 1ewa A: [15639]
Details for d1ewaa_
PDB Entry: 1ewa (more details), 2.5 Å
PDB Description: Dehaloperoxidase and 4-iodophenol
SCOP Domain Sequences for d1ewaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewaa_ a.1.1.2 (A:) Dehaloperoxidase {Marine worm (Amphitrite ornata)}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk
SCOP Domain Coordinates for d1ewaa_:
Click to download the PDB-style file with coordinates for d1ewaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ewaa_:
- d1ewaa_ appears in SCOP 1.57
- d1ewaa_ appears in the current release, SCOPe 2.08
View in 3D
