SCOPe 2.03: Domain d3c60c1: 3c60 C:83-182

Lineage for d3c60c1 (3c60 C:83-182)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (24 PDB entries)
probably orthologous to the human HLA-DQ group
Domain d3c60c1: 3c60 C:83-182 [155961]
Other proteins in same PDB: d3c60c2, d3c60d1, d3c60d2, d3c60g2, d3c60h1, d3c60h2
automatically matched to d1k2da1

Details for d3c60c1

PDB Entry: 3c60 (more details), 3.05 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr yae62

PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d3c60c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c60c1 b.1.1.2 (C:83-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOPe Domain Coordinates for d3c60c1:

Click to download the PDB-style file with coordinates for d3c60c1.
(The format of our PDB-style files is described here.)

Timeline for d3c60c1: