Lineage for d3c60h2 (3c60 H:1-120)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406673Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1406757Species Mouse (Mus musculus), I-AB [TaxId:10090] [88828] (5 PDB entries)
  8. 1406766Domain d3c60h2: 3c60 H:1-120 [155968]
    Other proteins in same PDB: d3c60c1, d3c60c2, d3c60d1, d3c60g1, d3c60g2, d3c60h1
    automatically matched to d1lnub2

Details for d3c60h2

PDB Entry: 3c60 (more details), 3.05 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr yae62
PDB Compounds: (H:) 3K peptide, Linker, and H-2 class II histocompatibility antigen (A beta chain)

SCOPe Domain Sequences for d3c60h2:

Sequence, based on SEQRES records: (download)

>d3c60h2 d.19.1.1 (H:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
feaqkakankavdggggslvprgsggggserhfvyqfmgecyftngtqriryvtryiynr
eeyvrydsdvgehravtelgrpdaeywnsqpeilertraeldtvcrhnyegpethtslrr

Sequence, based on observed residues (ATOM records): (download)

>d3c60h2 d.19.1.1 (H:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
feaqkakankavderhfvyqfmgecyftngtqriryvtryiynreeyvrydsdvgehrav
telgrpdaeywnsqpeilertraeldtvcrhnyegpethtslrr

SCOPe Domain Coordinates for d3c60h2:

Click to download the PDB-style file with coordinates for d3c60h2.
(The format of our PDB-style files is described here.)

Timeline for d3c60h2: