SCOP 1.75: Domain d3brda1: 3brd A:542-660

Lineage for d3brda1 (3brd A:542-660)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein DNA-binding protein LAG-1 (CSL) [110052] (1 species)

7. Species Caenorhabditis elegans [TaxId:6239] [110053] (4 PDB entries)
   Uniprot Q9TYY1 195-660

8. Domain d3brda1: 3brd A:542-660 [155505]
   Other proteins in same PDB: d3brda2, d3brda3
   automatically matched to d1ttua1
   complexed with edo

Details for d3brda1

PDB Entry: 3brd, 2.21 Å

PDB Description: csl (lag-1) bound to dna with lin-12 ram peptide, p212121

PDB Compounds: (A:) Lin-12 and glp-1 phenotype protein 1, isoform a

SCOP Domain Sequences for d3brda1:

Sequence; same for both SEQRES and ATOM records:

>d3brda1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]}
dkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvet
tfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyks

Timeline for d3brda1:

• d3brda1 is new in SCOP 1.75
  
• d3brda1 appears in SCOPe 2.01
  
• d3brda1 appears in the current release, SCOPe 2.08