Lineage for d3brda2 (3brd A:197-380)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 790093Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 790287Family b.2.5.8: DNA-binding protein LAG-1 (CSL) [110080] (1 protein)
  6. 790288Protein DNA-binding protein LAG-1 (CSL) [110081] (1 species)
  7. 790289Species Caenorhabditis elegans [TaxId:6239] [110082] (4 PDB entries)
    Uniprot Q9TYY1 195-660
  8. 790290Domain d3brda2: 3brd A:197-380 [155506]
    Other proteins in same PDB: d3brda1, d3brda3
    automatically matched to d1ttua2
    complexed with edo

Details for d3brda2

PDB Entry: 3brd (more details), 2.21 Å

PDB Description: csl (lag-1) bound to dna with lin-12 ram peptide, p212121
PDB Compounds: (A:) Lin-12 and glp-1 phenotype protein 1, isoform a

SCOP Domain Sequences for d3brda2:

Sequence, based on SEQRES records: (download)

>d3brda2 b.2.5.8 (A:197-380) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]}
sltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciyligqgwklkkdrv
aqlyktlkasaqkdaaiendpiheqqatelvayigigsdtserqqldfstgkvrhpgdqr
qdpniydycaaktlyisdsdkrkyfdlnaqffygcgmeiggfvsqrikviskpskkkqsm
kntd

Sequence, based on observed residues (ATOM records): (download)

>d3brda2 b.2.5.8 (A:197-380) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]}
sltsdrmidflsnkekyecvisifhakvaqksygnekrffcpppciyligqgwklkkdrv
aqlyktlqqatelvayigigsdtserqqldfpniydycaaktlyisdsdkrkyfdlnaqf
fygcgmeiggfvsqrikviskpskkktd

SCOP Domain Coordinates for d3brda2:

Click to download the PDB-style file with coordinates for d3brda2.
(The format of our PDB-style files is described here.)

Timeline for d3brda2: