SCOP 1.75: Domain d3brda3: 3brd A:381-541

Lineage for d3brda3 (3brd A:381-541)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.7: DNA-binding protein LAG-1 (CSL) [110217] (1 family)
   contains rudiment hairpin triplet lacking one hairpin

5. Family b.42.7.1: DNA-binding protein LAG-1 (CSL) [110218] (1 protein)

6. Protein DNA-binding protein LAG-1 (CSL) [110219] (1 species)

7. Species Caenorhabditis elegans [TaxId:6239] [110220] (4 PDB entries)
   Uniprot Q9TYY1 195-660

8. Domain d3brda3: 3brd A:381-541 [155507]
   Other proteins in same PDB: d3brda1, d3brda2
   automatically matched to d1ttua3
   complexed with edo

Details for d3brda3

PDB Entry: 3brd, 2.21 Å

PDB Description: csl (lag-1) bound to dna with lin-12 ram peptide, p212121

PDB Compounds: (A:) Lin-12 and glp-1 phenotype protein 1, isoform a

SCOP Domain Sequences for d3brda3:

Sequence, based on SEQRES records:

>d3brda3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]}
ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfdderglqetd
nfavrdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqm
idnelvylclshdkiiqhqatainehrhqindgaawtiist

Sequence, based on observed residues (ATOM records):

>d3brda3 b.42.7.1 (A:381-541) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]}
ckylciasgtkvalfnrlrsqtvstrylhvegnafhasstkwgaftihlfddqetdnfav
rdgfvyygsvvklvdsvtgialprlrirkvdkqqvildascseepvsqlhkcafqmidne
lvylclshdkiiqhqatainehrhqindgaawtiist

Timeline for d3brda3:

• d3brda3 is new in SCOP 1.75
  
• d3brda3 appears in SCOPe 2.01
  
• d3brda3 appears in the current release, SCOPe 2.08