![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
![]() | Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51023] (4 PDB entries) |
![]() | Domain d3bmwa3: 3bmw A:407-495 [155422] Other proteins in same PDB: d3bmwa1, d3bmwa2, d3bmwa4 automated match to d3bmva3 complexed with aci, ca, cl, gol, so4; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3bmw (more details), 1.6 Å
SCOPe Domain Sequences for d3bmwa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bmwa3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]} gttqqrwinndvyiyerkfgnnvalvainrnlstsynitglytalpagtytdvlggllng nsisvasdgsvtpftlsagevavwqyvss
Timeline for d3bmwa3: