![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
![]() | Family b.3.1.1: Starch-binding domain [49453] (3 proteins) automatically mapped to Pfam PF00686 |
![]() | Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
![]() | Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49459] (4 PDB entries) |
![]() | Domain d3bmwa2: 3bmw A:579-683 [155421] Other proteins in same PDB: d3bmwa1, d3bmwa3, d3bmwa4 automated match to d3bmwa2 complexed with aci, ca, cl, gol, so4; mutant |
PDB Entry: 3bmw (more details), 1.6 Å
SCOPe Domain Sequences for d3bmwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bmwa2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]} ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq
Timeline for d3bmwa2: