Lineage for d2yvxa3 (2yvx A:276-448)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1239872Fold f.57: MgtE membrane domain-like [161092] (1 superfamily)
    5 transmembrane helices; bundle, right-handed twist
  4. 1239873Superfamily f.57.1: MgtE membrane domain-like [161093] (1 family) (S)
    homodimer, swapped with the N-terminal helices
  5. 1239874Family f.57.1.1: MgtE membrane domain-like [161094] (1 protein)
    Pfam PF01769; Divalent cation transporter
  6. 1239875Protein Mg2+ transporter MgtE [161095] (1 species)
  7. 1239876Species Thermus thermophilus [TaxId:274] [161096] (1 PDB entry)
    Uniprot Q5SMG8 276-448
  8. 1239877Domain d2yvxa3: 2yvx A:276-448 [153783]
    Other proteins in same PDB: d2yvxa1, d2yvxa2, d2yvxb1, d2yvxb2, d2yvxc1, d2yvxc2, d2yvxd1, d2yvxd2
    complexed with mg

Details for d2yvxa3

PDB Entry: 2yvx (more details), 3.5 Å

PDB Description: Crystal structure of magnesium transporter MgtE
PDB Compounds: (A:) Mg2+ transporter MgtE

SCOPe Domain Sequences for d2yvxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvxa3 f.57.1.1 (A:276-448) Mg2+ transporter MgtE {Thermus thermophilus [TaxId: 274]}
agpvalwlarvrwlvililtgmvtssilqgfesvleavtalafyvpvllgtggntgnqsa
tliiralatrdldlrdwrrvflkemgvglllgltlsfllvgkvywdghplllpvvgvslv
livffanlvgamlpfllrrlgvdpalvsnplvatlsdvtglliylsvarllle

SCOPe Domain Coordinates for d2yvxa3:

Click to download the PDB-style file with coordinates for d2yvxa3.
(The format of our PDB-style files is described here.)

Timeline for d2yvxa3: