![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.57: MgtE membrane domain-like [161092] (1 superfamily) 5 transmembrane helices; bundle, right-handed twist |
![]() | Superfamily f.57.1: MgtE membrane domain-like [161093] (1 family) ![]() homodimer, swapped with the N-terminal helices |
![]() | Family f.57.1.1: MgtE membrane domain-like [161094] (1 protein) Pfam PF01769; Divalent cation transporter |
![]() | Protein Mg2+ transporter MgtE [161095] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [161096] (2 PDB entries) Uniprot Q5SMG8 276-448 |
![]() | Domain d2yvxa3: 2yvx A:276-448 [153783] Other proteins in same PDB: d2yvxa1, d2yvxa2, d2yvxb1, d2yvxb2, d2yvxc1, d2yvxc2, d2yvxd1, d2yvxd2 complexed with mg |
PDB Entry: 2yvx (more details), 3.5 Å
SCOPe Domain Sequences for d2yvxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvxa3 f.57.1.1 (A:276-448) Mg2+ transporter MgtE {Thermus thermophilus [TaxId: 274]} agpvalwlarvrwlvililtgmvtssilqgfesvleavtalafyvpvllgtggntgnqsa tliiralatrdldlrdwrrvflkemgvglllgltlsfllvgkvywdghplllpvvgvslv livffanlvgamlpfllrrlgvdpalvsnplvatlsdvtglliylsvarllle
Timeline for d2yvxa3: