Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.26: MgtE N-terminal domain-like [158791] (1 family) made of short helices; approximately 2.5 helices per turn of superhelix |
Family a.118.26.1: MgtE N-terminal domain-like [158792] (1 protein) Pfam PF03448 |
Protein Magnesium transporter MgtE [158793] (2 species) |
Species Thermus thermophilus [TaxId:274] [158795] (1 PDB entry) Uniprot Q5SMG8 7-131 |
Domain d2yvxc1: 2yvx C:7-131 [153787] Other proteins in same PDB: d2yvxa2, d2yvxa3, d2yvxb2, d2yvxb3, d2yvxc2, d2yvxc3, d2yvxd2, d2yvxd3 automatically matched to 2YVX A:7-131 complexed with mg |
PDB Entry: 2yvx (more details), 3.5 Å
SCOPe Domain Sequences for d2yvxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvxc1 a.118.26.1 (C:7-131) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} vslqealqegdtralrevleeihpqdllalwdelkgehryvvltllpkakaaevlshlsp eeqaeylktlppwrlreileelslddladalqavrkedpayfqrlkdlldprtraeveal aryee
Timeline for d2yvxc1: