Lineage for d2yvxa2 (2yvx A:132-275)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943255Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2943333Protein Magnesium transporter MgtE [160163] (2 species)
  7. 2943337Species Thermus thermophilus [TaxId:274] [160164] (2 PDB entries)
    Uniprot Q5SMG8 132-275
  8. 2943340Domain d2yvxa2: 2yvx A:132-275 [153782]
    Other proteins in same PDB: d2yvxa1, d2yvxa3, d2yvxb1, d2yvxb3, d2yvxc1, d2yvxc3, d2yvxd1, d2yvxd3
    complexed with mg

Details for d2yvxa2

PDB Entry: 2yvx (more details), 3.5 Å

PDB Description: Crystal structure of magnesium transporter MgtE
PDB Compounds: (A:) Mg2+ transporter MgtE

SCOPe Domain Sequences for d2yvxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]}
deagglmtpeyvavregmtveevlrflrraapdaetiyyiyvvdekgrlkgvlslrdliv
adprtrvaeimnpkvvyvrtdtdqeevarlmadydftvlpvvdeegrlvgivtvddvldv
leaeatedihklgavdvpdlvyse

SCOPe Domain Coordinates for d2yvxa2:

Click to download the PDB-style file with coordinates for d2yvxa2.
(The format of our PDB-style files is described here.)

Timeline for d2yvxa2: