Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein Magnesium transporter MgtE [160163] (2 species) |
Species Thermus thermophilus [TaxId:274] [160164] (2 PDB entries) Uniprot Q5SMG8 132-275 |
Domain d2yvxc2: 2yvx C:132-275 [153788] Other proteins in same PDB: d2yvxa1, d2yvxa3, d2yvxb1, d2yvxb3, d2yvxc1, d2yvxc3, d2yvxd1, d2yvxd3 automatically matched to 2YVX A:132-275 complexed with mg |
PDB Entry: 2yvx (more details), 3.5 Å
SCOPe Domain Sequences for d2yvxc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvxc2 d.37.1.1 (C:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} deagglmtpeyvavregmtveevlrflrraapdaetiyyiyvvdekgrlkgvlslrdliv adprtrvaeimnpkvvyvrtdtdqeevarlmadydftvlpvvdeegrlvgivtvddvldv leaeatedihklgavdvpdlvyse
Timeline for d2yvxc2: