![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141033] (4 PDB entries) Uniprot P13592 498-598 |
![]() | Domain d2vkxf1: 2vkx F:498-598 [153246] Other proteins in same PDB: d2vkxa3, d2vkxb3, d2vkxc3, d2vkxd3, d2vkxe3, d2vkxf3 automatically matched to d2haza1 complexed with so4; mutant |
PDB Entry: 2vkx (more details), 2.7 Å
SCOPe Domain Sequences for d2vkxf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vkxf1 b.1.2.1 (F:498-598) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} dtpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasm egivtivglkpettyavrlaalngkglgeisaasefktqpv
Timeline for d2vkxf1: