Lineage for d2vkxb1 (2vkx B:498-598)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2372076Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species)
  7. 2372077Species Human (Homo sapiens) [TaxId:9606] [141033] (4 PDB entries)
    Uniprot P13592 498-598
  8. 2372084Domain d2vkxb1: 2vkx B:498-598 [153238]
    Other proteins in same PDB: d2vkxa3, d2vkxb3, d2vkxc3, d2vkxd3, d2vkxe3, d2vkxf3
    automatically matched to d2haza1
    complexed with so4; mutant

Details for d2vkxb1

PDB Entry: 2vkx (more details), 2.7 Å

PDB Description: human ncam, fn3 domains 1 and 2, m610r mutant
PDB Compounds: (B:) neural cell adhesion molecule

SCOPe Domain Sequences for d2vkxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vkxb1 b.1.2.1 (B:498-598) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
dtpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasm
egivtivglkpettyavrlaalngkglgeisaasefktqpv

SCOPe Domain Coordinates for d2vkxb1:

Click to download the PDB-style file with coordinates for d2vkxb1.
(The format of our PDB-style files is described here.)

Timeline for d2vkxb1: