![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
![]() | Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries) |
![]() | Domain d2v69a2: 2v69 A:11-149 [152669] Other proteins in same PDB: d2v69a1, d2v69b1, d2v69c1, d2v69d1, d2v69e1, d2v69f1, d2v69g1, d2v69h1, d2v69i1, d2v69j1, d2v69k1, d2v69l1, d2v69m1, d2v69n1, d2v69o1, d2v69p1 automatically matched to d1gk8a2 complexed with cap, edo, mg, mme; mutant |
PDB Entry: 2v69 (more details), 2.8 Å
SCOP Domain Sequences for d2v69a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v69a2 d.58.9.1 (A:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]} agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal ralrledlrippayvktfv
Timeline for d2v69a2: