Lineage for d2v69f1 (2v69 F:150-469)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 818439Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 818440Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 818441Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 818466Species Chlamydomonas reinhardtii [TaxId:3055] [69403] (11 PDB entries)
  8. 818556Domain d2v69f1: 2v69 F:150-469 [152678]
    Other proteins in same PDB: d2v69a2, d2v69b2, d2v69c2, d2v69d2, d2v69e2, d2v69f2, d2v69g2, d2v69h2, d2v69i1, d2v69j1, d2v69k1, d2v69l1, d2v69m1, d2v69n1, d2v69o1, d2v69p1
    automatically matched to d1gk8a1
    complexed with cap, edo, mg, mme; mutant

Details for d2v69f1

PDB Entry: 2v69 (more details), 2.8 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit mutation d473e
PDB Compounds: (F:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d2v69f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v69f1 c.1.14.1 (F:150-469) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfef

SCOP Domain Coordinates for d2v69f1:

Click to download the PDB-style file with coordinates for d2v69f1.
(The format of our PDB-style files is described here.)

Timeline for d2v69f1: