Lineage for d2v69f2 (2v69 F:11-149)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862528Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 862529Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 862530Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 862555Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries)
  8. 862645Domain d2v69f2: 2v69 F:11-149 [152679]
    Other proteins in same PDB: d2v69a1, d2v69b1, d2v69c1, d2v69d1, d2v69e1, d2v69f1, d2v69g1, d2v69h1, d2v69i1, d2v69j1, d2v69k1, d2v69l1, d2v69m1, d2v69n1, d2v69o1, d2v69p1
    automatically matched to d1gk8a2
    complexed with cap, edo, mg, mme; mutant

Details for d2v69f2

PDB Entry: 2v69 (more details), 2.8 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit mutation d473e
PDB Compounds: (F:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d2v69f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v69f2 d.58.9.1 (F:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv

SCOP Domain Coordinates for d2v69f2:

Click to download the PDB-style file with coordinates for d2v69f2.
(The format of our PDB-style files is described here.)

Timeline for d2v69f2: