SCOP 1.75: Domain d2v69b2: 2v69 B:11-149

Lineage for d2v69b2 (2v69 B:11-149)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries)

8. Domain d2v69b2: 2v69 B:11-149 [152671]
   Other proteins in same PDB: d2v69a1, d2v69b1, d2v69c1, d2v69d1, d2v69e1, d2v69f1, d2v69g1, d2v69h1, d2v69i1, d2v69j1, d2v69k1, d2v69l1, d2v69m1, d2v69n1, d2v69o1, d2v69p1
   automatically matched to d1gk8a2
   complexed with cap, edo, mg, mme; mutant

Details for d2v69b2

PDB Entry: 2v69, 2.8 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit mutation d473e

PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d2v69b2:

Sequence; same for both SEQRES and ATOM records:

>d2v69b2 d.58.9.1 (B:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv

Timeline for d2v69b2:

• d2v69b2 is new in SCOP 1.75
  
• d2v69b2 appears in SCOPe 2.01
  
• d2v69b2 appears in the current release, SCOPe 2.08