Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.6: TK-like Pyr module [88735] (2 proteins) different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain |
Protein Transketolase (TK), Pyr module [88736] (4 species) |
Species Escherichia coli [TaxId:562] [89650] (4 PDB entries) |
Domain d2r8oa1: 2r8o A:333-527 [151731] Other proteins in same PDB: d2r8oa2, d2r8oa3, d2r8ob2, d2r8ob3 automatically matched to d1qgda1 complexed with ca, edo, t5x |
PDB Entry: 2r8o (more details), 1.47 Å
SCOPe Domain Sequences for d2r8oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r8oa1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]} mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg ptalilsrqnlaqqe
Timeline for d2r8oa1: