SCOP 1.75: Domain d2r8oa1: 2r8o A:333-527

Lineage for d2r8oa1 (2r8o A:333-527)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.6: TK-like Pyr module [88735] (2 proteins)
   different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain

6. Protein Transketolase (TK), Pyr module [88736] (4 species)

7. Species Escherichia coli [TaxId:562] [89650] (4 PDB entries)

8. Domain d2r8oa1: 2r8o A:333-527 [151731]
   Other proteins in same PDB: d2r8oa2, d2r8oa3, d2r8ob2, d2r8ob3
   automatically matched to d1qgda1
   complexed with ca, edo, t5x

Details for d2r8oa1

PDB Entry: 2r8o, 1.47 Å

PDB Description: transketolase from e. coli in complex with substrate d-xylulose-5- phosphate

PDB Compounds: (A:) Transketolase 1

SCOP Domain Sequences for d2r8oa1:

Sequence; same for both SEQRES and ATOM records:

>d2r8oa1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]}
mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg
skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk
qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg
ptalilsrqnlaqqe

Timeline for d2r8oa1:

• d2r8oa1 is new in SCOP 1.75
  
• d2r8oa1 appears in SCOPe 2.01
  
• d2r8oa1 appears in the current release, SCOPe 2.08