![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) ![]() |
![]() | Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins) |
![]() | Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [81459] (5 PDB entries) the "missing" first helix is complemented by the ba3 subunit IIa |
![]() | Domain d2qpdb2: 2qpd B:3-36 [151200] Other proteins in same PDB: d2qpdb1, d2qpdc1 automatically matched to d1ehkb2 complexed with cu1, cua, has, hem |
PDB Entry: 2qpd (more details), 3.25 Å
SCOPe Domain Sequences for d2qpdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpdb2 f.17.2.1 (B:3-36) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]} dehkahkailayekgwlafslamlfvfialiayt
Timeline for d2qpdb2: