Lineage for d2qpdb2 (2qpd B:3-36)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237582Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1237604Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 1237605Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 1237620Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)
  7. 1237621Species Thermus thermophilus [TaxId:274] [81459] (5 PDB entries)
    the "missing" first helix is complemented by the ba3 subunit IIa
  8. 1237625Domain d2qpdb2: 2qpd B:3-36 [151200]
    Other proteins in same PDB: d2qpdb1, d2qpdc1
    automatically matched to d1ehkb2
    complexed with cu1, cua, has, hem

Details for d2qpdb2

PDB Entry: 2qpd (more details), 3.25 Å

PDB Description: an unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2qpdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qpdb2 f.17.2.1 (B:3-36) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dehkahkailayekgwlafslamlfvfialiayt

SCOPe Domain Coordinates for d2qpdb2:

Click to download the PDB-style file with coordinates for d2qpdb2.
(The format of our PDB-style files is described here.)

Timeline for d2qpdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qpdb1
View in 3D
Domains from other chains:
(mouse over for more information)
d2qpdc1