![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) ![]() |
![]() | Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (1 protein) |
![]() | Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species) functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II |
![]() | Species Thermus thermophilus [TaxId:274] [81470] (19 PDB entries) |
![]() | Domain d2qpdc1: 2qpd C:2-34 [151201] Other proteins in same PDB: d2qpdb1, d2qpdb2 automatically matched to d1ehkc_ complexed with cu1, cua, has, hem |
PDB Entry: 2qpd (more details), 3.25 Å
SCOPe Domain Sequences for d2qpdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpdc1 f.23.9.1 (C:2-34) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]} eekpkgalavilvltltilvfwlgvyavffarg
Timeline for d2qpdc1: