SCOPe 2.08: Domain d2qpdb2: 2qpd B:3-36

Lineage for d2qpdb2 (2qpd B:3-36)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)

7. Species Thermus thermophilus [TaxId:274] [81459] (23 PDB entries)
   the "missing" first helix is complemented by the ba3 subunit IIa

8. Domain d2qpdb2: 2qpd B:3-36 [151200]
   Other proteins in same PDB: d2qpdb1, d2qpdc1
   automatically matched to d1ehkb2
   complexed with cu1, cua, has, hem
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2qpdb2

PDB Entry: 2qpd, 3.25 Å

PDB Description: an unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2qpdb2:

Sequence; same for both SEQRES and ATOM records:

>d2qpdb2 f.17.2.1 (B:3-36) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dehkahkailayekgwlafslamlfvfialiayt

Timeline for d2qpdb2:

• d2qpdb2 first appeared in SCOP 1.75
  
• d2qpdb2 appears in SCOPe 2.07