Lineage for d2qnhf1 (2qnh f:5-154)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897616Family i.1.1.3: Small subunit [58132] (1 protein)
  6. 897617Protein 30S subunit [58133] (1 species)
  7. 897618Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 897657Domain d2qnhf1: 2qnh f:5-154 [150929]
    Other proteins in same PDB: d2qnhc1, d2qnhe1, d2qnhg1, d2qnhh1, d2qnhi1, d2qnhj1, d2qnhk1, d2qnhl1, d2qnhm1, d2qnhn1, d2qnho1, d2qnhp1, d2qnhq1, d2qnhr1, d2qnhs1, d2qnht1, d2qnhu1, d2qnhv1
    automatically matched to d1fkae_
    complexed with 2mg, 5mc, 7mg, m2g, ma6, psu

Details for d2qnhf1

PDB Entry: 2qnh (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 2QNH, contains the 30S ribosome subunit, two TRNA, and MRNA molecules. 50S ribosome subunit is in the file 1VSP.
PDB Compounds: (f:) 30S ribosomal protein S5

SCOP Domain Sequences for d2qnhf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qnhf1 i.1.1.3 (f:5-154) 30S subunit {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
srnpiniayatmealrqlrtkadverlrkg

SCOP Domain Coordinates for d2qnhf1:

Click to download the PDB-style file with coordinates for d2qnhf1.
(The format of our PDB-style files is described here.)

Timeline for d2qnhf1: