| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) ![]() |
| Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
| Protein Ribosomal protein S7 [47975] (4 species) |
| Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries) Uniprot P17291 |
| Domain d2qnhh1: 2qnh h:2-156 [150931] Other proteins in same PDB: d2qnhc1, d2qnhe1, d2qnhf1, d2qnhg1, d2qnhi1, d2qnhj1, d2qnhk1, d2qnhl1, d2qnhm1, d2qnhn1, d2qnho1, d2qnhp1, d2qnhq1, d2qnhr1, d2qnhs1, d2qnht1, d2qnhu1, d2qnhv1 automatically matched to d1fjgg_ complexed with 2mg, 5mc, 7mg, m2g, ma6, psu |
PDB Entry: 2qnh (more details), 3.83 Å
SCOP Domain Sequences for d2qnhh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qnhh1 a.75.1.1 (h:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw
Timeline for d2qnhh1: