Lineage for d2qnho1 (2qnh o:2-61)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892700Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 892701Protein Ribosomal protein S14 [57753] (2 species)
  7. 892727Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 892764Domain d2qnho1: 2qnh o:2-61 [150938]
    Other proteins in same PDB: d2qnhc1, d2qnhe1, d2qnhf1, d2qnhg1, d2qnhh1, d2qnhi1, d2qnhj1, d2qnhk1, d2qnhl1, d2qnhm1, d2qnhn1, d2qnhp1, d2qnhq1, d2qnhr1, d2qnhs1, d2qnht1, d2qnhu1, d2qnhv1
    automatically matched to d1fjgn_
    complexed with 2mg, 5mc, 7mg, m2g, ma6, psu

Details for d2qnho1

PDB Entry: 2qnh (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 2QNH, contains the 30S ribosome subunit, two TRNA, and MRNA molecules. 50S ribosome subunit is in the file 1VSP.
PDB Compounds: (o:) 30s ribosomal protein s14 type z

SCOP Domain Sequences for d2qnho1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qnho1 g.39.1.7 (o:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d2qnho1:

Click to download the PDB-style file with coordinates for d2qnho1.
(The format of our PDB-style files is described here.)

Timeline for d2qnho1: