SCOP 1.75: Domain d1fkae

Lineage for d1fkae_ (1fka E:)

Root: SCOP 1.75
Class i: Low resolution protein structures [58117] (26 folds)
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)
Family i.1.1.3: Small subunit [58132] (1 protein)
Protein 30S subunit [58133] (1 species)
Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
Domain d1fkae_: 1fka E: [45848]

Details for d1fkae_

PDB Entry: 1fka (more details), 3.3 Å

PDB Description: structure of functionally activated small ribosomal subunit at 3.3 a resolution

PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d1fkae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkae_ i.1.1.3 (E:) 30S subunit {Thermus thermophilus [TaxId: 274]}
mpetdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagy
yarrnmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdilt
kelgsrnpiniayatmealrqlrtkadverlrkgeah

SCOP Domain Coordinates for d1fkae_:

Click to download the PDB-style file with coordinates for d1fkae_.
(The format of our PDB-style files is described here.)

Timeline for d1fkae_:

d1fkae_ first appeared (with stable ids) in SCOP 1.55
d1fkae_ appears in SCOP 1.73
d1fkae_ appears in SCOPe 2.01
d1fkae_ appears in the current release, SCOPe 2.08