![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S12 [50302] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [159087] (25 PDB entries) Uniprot P0A7S3 1-123 |
![]() | Domain d2qb9l1: 2qb9 L:1-123 [150339] Other proteins in same PDB: d2qb9b1, d2qb9c1, d2qb9c2, d2qb9d1, d2qb9e1, d2qb9e2, d2qb9f1, d2qb9g1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9r1, d2qb9s1, d2qb9t1, d2qb9u1 automatically matched to 2AVY L:1-123 protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qb9 (more details), 3.54 Å
SCOPe Domain Sequences for d2qb9l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qb9l1 b.40.4.5 (L:1-123) Ribosomal protein S12 {Escherichia coli [TaxId: 562]} atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr pka
Timeline for d2qb9l1: