SCOPe 2.02: Domain d2qb9c2: 2qb9 C:106-206

Lineage for d2qb9c2 (2qb9 C:106-206)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
   Uniprot P0A7V3 106-206

8. Domain d2qb9c2: 2qb9 C:106-206 [150329]
   Other proteins in same PDB: d2qb9b1, d2qb9c1, d2qb9d1, d2qb9e1, d2qb9e2, d2qb9f1, d2qb9g1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9l1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9r1, d2qb9s1, d2qb9t1, d2qb9u1
   automatically matched to 2AVY C:106-206
   protein/RNA complex; complexed with lll, mg

Details for d2qb9c2

PDB Entry: 2qb9, 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 30S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2qb9c2:

Sequence; same for both SEQRES and ATOM records:

>d2qb9c2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

Timeline for d2qb9c2:

• d2qb9c2 first appeared in SCOP 1.75
  
• d2qb9c2 appears in SCOPe 2.01
  
• d2qb9c2 appears in SCOPe 2.03
  
• d2qb9c2 appears in the current release, SCOPe 2.08