Lineage for d2qb9u1 (2qb9 U:3-53)

  1. Root: SCOPe 2.02
  2. 1251156Class j: Peptides [58231] (120 folds)
  3. 1253012Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 1253013Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) (S)
  5. 1253014Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
    Pfam PF01165
  6. 1253015Protein Ribosomal protein S21, RpsU [161310] (1 species)
  7. 1253016Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
    Uniprot P68679 4-54
  8. 1253029Domain d2qb9u1: 2qb9 U:3-53 [150347]
    Other proteins in same PDB: d2qb9b1, d2qb9c1, d2qb9c2, d2qb9d1, d2qb9e1, d2qb9e2, d2qb9f1, d2qb9g1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9l1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9r1, d2qb9s1, d2qb9t1
    automatically matched to 2AVY U:3-53
    protein/RNA complex; complexed with lll, mg

Details for d2qb9u1

PDB Entry: 2qb9 (more details), 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 30S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2qb9u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qb9u1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

SCOPe Domain Coordinates for d2qb9u1:

Click to download the PDB-style file with coordinates for d2qb9u1.
(The format of our PDB-style files is described here.)

Timeline for d2qb9u1: