Lineage for d2ogkd_ (2ogk D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913862Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 1913863Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 1913955Family d.77.1.2: SSO1042-like [160489] (5 proteins)
    Pfam PF01877; DUF54
  6. 1913962Protein Hypothetical protein AF2318 [160492] (1 species)
  7. 1913963Species Archaeoglobus fulgidus [TaxId:2234] [160493] (1 PDB entry)
    Uniprot O27966 3-143
  8. 1913967Domain d2ogkd_: 2ogk D: [148770]
    automated match to d2ogka1

Details for d2ogkd_

PDB Entry: 2ogk (more details), 3 Å

PDB Description: crystal structure of protein af2318 from archaeglobus fulgidus, pfam duf54
PDB Compounds: (D:) hypothetical protein

SCOPe Domain Sequences for d2ogkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ogkd_ d.77.1.2 (D:) Hypothetical protein AF2318 {Archaeoglobus fulgidus [TaxId: 2234]}
kgkiewvrvsavvhstedrekvgeaistlfpfefeiavskakghygnpmeyleveltkss
eikkfwknllellgeqaeeilstledrideqnvlhiridkqkaylgevsltsggdpiavk
lrlvtypskrekviefarelct

SCOPe Domain Coordinates for d2ogkd_:

Click to download the PDB-style file with coordinates for d2ogkd_.
(The format of our PDB-style files is described here.)

Timeline for d2ogkd_: